PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006318
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 204aa    MW: 23388.4 Da    PI: 8.5871
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006318genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.18.4e-27959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+ien++nrqvt+skRrngi+KKA+EL vLCda++++i++sst k +ey s
  PGSC0003DMP400006318  9 KKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTS 59
                          68***********************************************75 PP

2K-box55.91.8e-19811463398
                 K-box  33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                           +++  + Ged++ L+l+eL +L++++ +s+ +iR++K++++++q+++ +kk ++l+e++ +L   l
  PGSC0003DMP400006318  81 STHYERTGEDMSGLNLQELCHLQENITESVAEIRERKYHVIKNQTDTCRKKVRNLEEQHGNLVLDL 146
                           6778899****************************************************9997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SMARTSM004326.5E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-34288IPR002100Transcription factor, MADS-box
CDDcd002653.90E-38280No hitNo description
PRINTSPR004046.3E-26323IPR002100Transcription factor, MADS-box
PfamPF003198.3E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.87854152IPR002487Transcription factor, K-box
PfamPF014861.4E-1483143IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MGRGKIEIKK IENSTNRQVT YSKRRNGIFK KAKELTVLCD AKISLIMLSS TRKYHEYTSP  60
NTTTKKMIDQ YQSALGVDIW STHYERTGED MSGLNLQELC HLQENITESV AEIRERKYHV  120
IKNQTDTCRK KVRNLEEQHG NLVLDLEAKC EDPKYGVVEN EGHYNSAVAF ANGVHNLYAF  180
RLQPLHPNLQ NEEGFGSRDL RLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J1e-13261160Myocyte-specific enhancer factor 2A
3p57_I1e-13261160Myocyte-specific enhancer factor 2A
3p57_D1e-13261160Myocyte-specific enhancer factor 2A
3p57_C1e-13261160Myocyte-specific enhancer factor 2A
3p57_B1e-13261160Myocyte-specific enhancer factor 2A
3p57_A1e-13261160Myocyte-specific enhancer factor 2A
3kov_J1e-13261160Myocyte-specific enhancer factor 2A
3kov_I1e-13261160Myocyte-specific enhancer factor 2A
3kov_B1e-13261160Myocyte-specific enhancer factor 2A
3kov_A1e-13261160Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755164e-66HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340689.11e-147PREDICTED: floral homeotic protein DEFICIENS-like
SwissprotP237061e-77DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLM0ZVL51e-152M0ZVL5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000091121e-147(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.12e-61MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]